translateDNA - Translate nucleotide sequences to amino acids

Description

translateDNA translates nucleotide sequences to amino acid sequences.

Usage

translateDNA(seq, trim = FALSE)

Arguments

seq
vector of strings defining DNA sequence(s) to be converted to translated.
trim
boolean flag to remove 3 nts from both ends of seq (converts IMGT junction to CDR3 region).

Value

A vector of translated sequence strings.

Examples

# Translate a single sequence
translateDNA("ACTGACTCGA")

[1] "TDS"


# Translate a vector of sequences
translateDNA(ExampleDb$JUNCTION[1:3])

[1] "CARVKRRGWRRNSLWFGESTPSDAHRWFDPW" "CARMVILGSCYSRGCGTPGPGDGETQYW"    "CARVGIDVVVPAAIPGFDYYYGMDVW"     


# Remove the first and last codon from the translation
translateDNA(ExampleDb$JUNCTION[1:3], trim=TRUE)
[1] "ARVKRRGWRRNSLWFGESTPSDAHRWFDP" "ARMVILGSCYSRGCGTPGPGDGETQY"    "ARVGIDVVVPAAIPGFDYYYGMDV"     

See also

[translate](http://www.rdocumentation.org/packages/seqinr/topics/translate).